DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and Tomm40l

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001076807.1 Gene:Tomm40l / 304971 RGDID:1562006 Length:308 Species:Rattus norvegicus


Alignment Length:289 Identity:69/289 - (23%)
Similarity:125/289 - (43%) Gaps:27/289 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSH-IRPSGFRFGG--LYTFRVQ 94
            |||:...||.|...|.|...:|:      :|..||.:::.:.::| :..|.....|  |:|....
  Rat    26 NPGSFDELHRLCKDVFPAQMEGV------KLVVNKVLSSHFQVAHTVHMSALGLPGYHLHTAYAG 84

  Fly    95 D----DTMYTPTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTW 155
            |    .|...||::||: .:|.:.|..:|....:.||.:||.|..:...:..|:..|:..  |.:
  Rat    85 DWQLSPTEVFPTVVGDM-DSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRG--DDY 146

  Fly   156 TANFY----NVRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYSLAA 216
            ||...    ::..||.......::|::....|||||:.. ..|.:....|.||.:||..::....
  Rat   147 TATLTLGNPDLIGESVIMVAHFLQSITHRLVLGGELVYH-RRPGEEGAILTLAGKYSALHWVATL 210

  Fly   217 TASRQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNFW----NSAVHGMFDSDASVGF 277
            .....|...:|:.:.:..:|:.  :.:..|||....|..:.::..    :....|:.||:..||.
  Rat   211 NVGSGGAHASYYHKANEQVQVG--VEFEANTRLQDTTFSFGYHLTLPQADMVFRGLVDSNWCVGA 273

  Fly   278 MWTKYLTHLPLQMGFSVVMNLPTDRFAFG 306
            :..|.:..||:.:.....:|...:||..|
  Rat   274 VLEKKMRPLPVTLALGAFLNHWRNRFHCG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 69/289 (24%)
Tomm40lNP_001076807.1 Porin3_Tom40 24..308 CDD:132766 69/289 (24%)
Required for mitochondrial targeting. /evidence=ECO:0000269|PubMed:17437969 281..308 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.