DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and tomm-40

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_495912.1 Gene:tomm-40 / 174431 WormBaseID:WBGene00007686 Length:301 Species:Caenorhabditis elegans


Alignment Length:295 Identity:73/295 - (24%)
Similarity:134/295 - (45%) Gaps:27/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSH-----IRPSGFRFGGLY--T 90
            |||:.:.||..|..|.|..::|.      :|..||.:::.:.:||     ...:|:|||..|  |
 Worm    17 NPGSYEELHRKARDVFPTCFEGA------KLMVNKGLSSHFQVSHTLSLSAMNTGYRFGATYVGT 75

  Fly    91 FRVQDDTMYTPTIMG--DIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCD 153
            .:|.....| |.::|  |::..:.|..|:.|  .....:::..:|:.:.|.  :|.|||......
 Worm    76 NQVGPAEAY-PILLGDTDVNGNTTATILHQL--GIYRTKLQGQIQQGKLAG--AQATIERKGRLS 135

  Fly   154 TWTANFYNVR--NESGRCTMSVMRSVSAHWALGGELLLEW--NDPQKLTPDLALAARYSHYNYSL 214
            |......|:.  ||:|......:|.::....:|.|::.::  |.|......|:.||||:..::..
 Worm   136 TLGLTLANIDLVNEAGILVGQFLRRLTPRLDVGTEMVYQYGKNIPGGQISVLSYAARYTANHFIA 200

  Fly   215 AATASRQGLDVTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNFWNSAV--HGMFDSDASVGF 277
            |||....|:.:||:.:.:.::........|.|..:.:.|:.||.......|  ...||::.:||.
 Worm   201 AATLGASGVHLTYYHKQNENLAFGVEFECNANVGEAVTTLAYQTELPEEGVTMRASFDTNWTVGG 265

  Fly   278 MWTKYLT-HLPLQMGFSVVMNLPTDRFAFGMRFVL 311
            ::.|.|: .||..:..|..:|.......||:..::
 Worm   266 VFEKRLSQQLPFTLALSGTLNHVKAAGKFGIGLII 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 73/295 (25%)
tomm-40NP_495912.1 Porin3_Tom40 16..301 CDD:132766 73/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.