DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4520 and TOMM40

DIOPT Version :9

Sequence 1:NP_001287340.1 Gene:CG4520 / 41902 FlyBaseID:FBgn0038355 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001122388.1 Gene:TOMM40 / 10452 HGNCID:18001 Length:361 Species:Homo sapiens


Alignment Length:282 Identity:68/282 - (24%)
Similarity:116/282 - (41%) Gaps:9/282 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPGNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSHIRPSGFRFGGLYTFRVQ-DD 96
            |||..:..|.....:.|...:|::|.....|:.:..:.....||.|..|.:.||..|....| ..
Human    79 NPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSP 143

  Fly    97 TMYTPTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTRPCDTWTANFYN 161
            |...|.::||: ..|.:.|..:::.....||.:..:|..:...|..|...|:.....|......|
Human   144 TEAFPVLVGDM-DNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGN 207

  Fly   162 --VRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPDLALAARYSHYNYSLAATASRQGLD 224
              |...||......::|::...||||||:......::.|. ::||.:|:..|:....|..:.|:.
Human   208 PDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTV-MSLAGKYTLNNWLATVTLGQAGMH 271

  Fly   225 VTYWQRIHPHIQMANLLAWNRNTRKTIATICYQWNF--WNSAVHGMFDSDASVGFMWTKYLTHLP 287
            .||:.:....:|:......:...:.|..:..||.:.  .|....|..||:..||....|.|..||
Human   272 ATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLP 336

  Fly   288 LQMGFSVVMNLPTDRF--AFGM 307
            |.:.....:|...::|  .||:
Human   337 LTLALGAFLNHRKNKFQCGFGL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4520NP_001287340.1 Porin3_Tom40 33..312 CDD:132766 68/282 (24%)
TOMM40NP_001122388.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
Porin3_Tom40 77..361 CDD:132766 68/282 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3296
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1346842at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.