DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AOX3 and AT4G37500

DIOPT Version :9

Sequence 1:NP_001303439.1 Gene:AOX3 / 41896 FlyBaseID:FBgn0038349 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_195466.1 Gene:AT4G37500 / 829905 AraportID:AT4G37500 Length:124 Species:Arabidopsis thaliana


Alignment Length:89 Identity:34/89 - (38%)
Similarity:46/89 - (51%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   969 AIYHV--DGTVVVTHGGIEMGQGMNTKVAQVAAYTLGIDLSFIKVESSDTINGANSMVTGGAVGS 1031
            |:.||  :|||:|||||:|||||...|...       |.||.:.|..:.|....|:..|..:..|
plant    36 ALVHVCTNGTVLVTHGGVEMGQGFAYKGCV-------IPLSSVFVSETSTYKVPNASPTAASASS 93

  Fly  1032 ESLCYAVRKACETLNSRLEPVKKK 1055
            :....||..|.|.:.::||||..|
plant    94 DMYGAAVLDAVEQIIAKLEPVASK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AOX3NP_001303439.1 PLN02906 24..1238 CDD:215491 34/89 (38%)
Fer2_2 80..153 CDD:280048
FAD_binding_4 201..360 CDD:303082
CO_deh_flav_C 386..487 CDD:281449
Ald_Xan_dh_C 540..646 CDD:214971
Ald_Xan_dh_C2 688..1172 CDD:280834 34/89 (38%)
AT4G37500NP_195466.1 PLN02906 <33..122 CDD:215491 34/89 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.