DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AOX1 and AT4G37500

DIOPT Version :9

Sequence 1:NP_650475.1 Gene:AOX1 / 41894 FlyBaseID:FBgn0267408 Length:1273 Species:Drosophila melanogaster
Sequence 2:NP_195466.1 Gene:AT4G37500 / 829905 AraportID:AT4G37500 Length:124 Species:Arabidopsis thaliana


Alignment Length:117 Identity:37/117 - (31%)
Similarity:53/117 - (45%) Gaps:22/117 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   958 KENRWHKRGLGLCIMEYQIGYFGQYPATVAIYH--SDGTVVVSHGGIEMGQGMNTKISQVAAHTL 1020
            |...|..|.|...|:..|.|         |:.|  ::|||:|:|||:|||||...|         
plant    16 KSRIWILRYLLQHILLLQAG---------ALVHVCTNGTVLVTHGGVEMGQGFAYK--------- 62

  Fly  1021 G--IPMEQVRIEASDTINGANSMVTGGAVGSETLCFAVRKACETLNERLKPV 1070
            |  ||:..|.:..:.|....|:..|..:..|:....||..|.|.:..:|:||
plant    63 GCVIPLSSVFVSETSTYKVPNASPTAASASSDMYGAAVLDAVEQIIAKLEPV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AOX1NP_650475.1 fer2 4..85 CDD:238126
PLN02906 28..1259 CDD:215491 37/117 (32%)
Fer2_2 86..159 CDD:280048
FAD_binding_4 211..373 CDD:303082
CO_deh_flav_C 399..502 CDD:281449
Ald_Xan_dh_C 555..666 CDD:214971
Ald_Xan_dh_C2 711..1192 CDD:280834 37/117 (32%)
AT4G37500NP_195466.1 PLN02906 <33..122 CDD:215491 32/100 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.