DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44014 and Obp1b

DIOPT Version :10

Sequence 1:NP_732043.1 Gene:CG44014 / 41893 FlyBaseID:FBgn0264776 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001297257.1 Gene:Obp1b / 628991 MGIID:1277948 Length:171 Species:Mus musculus


Alignment Length:99 Identity:25/99 - (25%)
Similarity:38/99 - (38%) Gaps:16/99 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QLSGYWYEAA-RVPNVQVLECLNVSVPAEI-------ENDILSLDLNFISTVNNGWQFTEESVEF 108
            :|.|.|...| ...|:..:|   .|.|.|:       :.....:.:.|.  |....|.:..:|..
Mouse    24 ELQGQWKTTAIMADNIDKIE---TSGPLELFVREITCDEGCQKMKVTFY--VKQNGQCSLTTVTG 83

  Fly   109 PWNEDTQTGIFKLDYDTVTVTYKLMLTDYENIAF 142
            ...||.:|  ||..|:... .|||:....||:.|
Mouse    84 YKQEDGKT--FKNQYEGEN-NYKLLKATSENLVF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44014NP_732043.1 Lipocalin 54..184 CDD:395015 24/97 (25%)
Obp1bNP_001297257.1 lipocalin_OBP-like 22..169 CDD:381202 25/99 (25%)

Return to query results.
Submit another query.