DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44014 and CG44013

DIOPT Version :9

Sequence 1:NP_732043.1 Gene:CG44014 / 41893 FlyBaseID:FBgn0264776 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001262606.1 Gene:CG44013 / 14462476 FlyBaseID:FBgn0264775 Length:219 Species:Drosophila melanogaster


Alignment Length:214 Identity:93/214 - (43%)
Similarity:133/214 - (62%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAQKYMLPILLLFCCCGIPLEVGAIRMRMPTLPEEL---NCRNESIHFNFNLTQLSGYWYEAAR 62
            |:.|.:...:||.||.|||.      .:.:|.|||.|   .|:.:.:.|.||||.|:|.||||.:
  Fly     1 MKDQIFNRSLLLAFCICGIE------AITLPRLPENLQDFKCQEDDVGFKFNLTDLAGTWYEALQ 59

  Fly    63 VPNVQVLECLNVSVPAEIENDILSLDLNFISTVNNGWQFTEESVEFPWNEDTQTGIFKLDYDTVT 127
            :|:|..:||||||:|:.:..:.|:|||::::.:||.|..:.|:|.||||..||.|||  ..|...
  Fly    60 MPSVPGMECLNVSIPSAVSGNNLTLDLSYVTILNNSWSLSREAVSFPWNNSTQYGIF--HPDASK 122

  Fly   128 VTYKLMLTDYENIAFVCGFGSISPVPLFKLFTRKRELSQEMINLAKSYAEQYGMGNQIAWEMQSP 192
            |:|||:.|||.:||.|||:||.|.:|:||.|||.||:|:|:..|..:.||:.|..:.|.||.||.
  Fly   123 VSYKLVTTDYVSIAVVCGYGSTSLIPIFKFFTRDREVSEEIFELINTQAEENGYSSLIYWEKQSV 187

  Fly   193 GECNGSGGLFPMAILMATV 211
            .||....|...:|.|:..:
  Fly   188 EECREPSGQPALAALVGLI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44014NP_732043.1 Lipocalin 54..184 CDD:278490 62/129 (48%)
CG44013NP_001262606.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5492
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019536
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.