DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and PAB1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_011092.1 Gene:PAB1 / 856912 SGDID:S000000967 Length:577 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:60/238 - (25%)
Similarity:100/238 - (42%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IRGMFQTGRPVDPPPPLPNLRMK----------TNLILNYLPQDMTESELHRLFSKFGEIRKAKI 72
            :.||...|:.:...|.|......          |||.:..:..:.|:.:...||:|||.|..|.:
Yeast   186 LNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL 250

  Fly    73 IRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRLKVAFAR---------PSEYES---- 124
            .:. ..|....:|||:|.....|..||..::..|..|::|.|..|:         ..:||:    
Yeast   251 EKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLE 314

  Fly   125 -----TSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVA 184
                 ...:|:|.||...:|::|:.|.||.||.|....::|.: |.:|:|..|:.|....:|..|
Yeast   315 KMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTE-NGKSKGFGFVCFSTPEEATKA 378

  Fly   185 KYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKS 227
            ....::.::.|  :||.|...:|              ||.|:|
Yeast   379 ITEKNQQIVAG--KPLYVAIAQR--------------KDVRRS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/75 (31%)
RRM 128..202 CDD:214636 23/73 (32%)
PAB1NP_011092.1 PABP-1234 38..559 CDD:130689 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.