DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT1G60000

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_176208.1 Gene:AT1G60000 / 842294 AraportID:AT1G60000 Length:258 Species:Arabidopsis thaliana


Alignment Length:188 Identity:48/188 - (25%)
Similarity:85/188 - (45%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSE 92
            :|||     ..:.|.|....||.::..:.|.::...|......:::.:|.||.|..:.||...:.
plant    77 LDPP-----AAVNTKLYFGNLPYNVDSATLAQIIQDFANPELVEVLYNRDTGQSRGFAFVTMSNV 136

  Fly    93 RQAAAAVNGMDGYETRGKRLKVAFA---RPSE---YESTSSSLYVGNLPTYMDEKKVRELFATYG 151
            ......::.:||.|..|:.|||.||   :|::   |..|...|:||||...:..:.:...|...|
plant   137 EDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPLYPETEHKLFVGNLSWTVTSESLAGAFRECG 201

  Fly   152 NIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREK 209
            ::|...::......||||..|:.:....:.|.|...:|.:.:||  |.:.|...:.:|
plant   202 DVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALESLDGFELEG--RAIRVNLAQGKK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/75 (25%)
RRM 128..202 CDD:214636 19/73 (26%)
AT1G60000NP_176208.1 RRM_SF 86..165 CDD:418427 20/78 (26%)
RRM2_NsCP33_like 178..253 CDD:410187 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.