DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT1G01080

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001030925.1 Gene:AT1G01080 / 839463 AraportID:AT1G01080 Length:294 Species:Arabidopsis thaliana


Alignment Length:218 Identity:52/218 - (23%)
Similarity:85/218 - (38%) Gaps:55/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKII-RHRRTGISCCYGFVDYV 90
            ||..|.|       ..|.:..:|:....::|..:|..||.:...::: |:.:||.|...|:|...
plant   101 PVKKPRP-------CELYVCNIPRSYDIAQLLDMFQPFGTVISVEVVSRNPQTGESRGSGYVTMG 158

  Fly    91 SERQAAAAVNGMDGYETRGKRLKVAFA---------RPSEYESTSSSL---------YVGNLPTY 137
            |...|..|:..:||.|..|:.::|.::         .|....||...:         ||||||.:
plant   159 SINSAKIAIASLDGTEVGGREMRVRYSVDMNPGTRRNPEVLNSTPKKILMYESQHKVYVGNLPWF 223

  Fly   138 MDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTV 202
            .....:|..|:.:|.||...:|..:...|:|..|||.|                 ..|..|...:
plant   224 TQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSF-----------------TSGEERDAAL 271

  Fly   203 KFVEREKKGSSSTSSGSQYKDKR 225
            .|            :|:||:.:|
plant   272 SF------------NGTQYEGRR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/76 (26%)
RRM 128..202 CDD:214636 20/82 (24%)
AT1G01080NP_001030925.1 RRM_SF 110..183 CDD:302621 19/72 (26%)
RRM 214..285 CDD:214636 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.