DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and CP31B

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:190 Identity:55/190 - (28%)
Similarity:90/190 - (47%) Gaps:17/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQ 94
            |.||     .:..|.:..||.|:....|..||.:.|.:..:::|.:|.|..|..:|||...:..:
plant   107 PEPP-----EEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEE 166

  Fly    95 AAAAVNGMDGYETRGKRLKVAFA---------RPSEYESTSSSLYVGNLPTYMDEKKVRELFATY 150
            |..||...:.:|..|:||.|..|         :|..|:: :..:||||||..:|..::..||:.:
plant   167 AEKAVEKFNSFEVNGRRLTVNRAAPRGSRPERQPRVYDA-AFRIYVGNLPWDVDSGRLERLFSEH 230

  Fly   151 GNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKK 210
            |.:||..::..:...||||..|:|.....:..||...:|...:||  |.:.|...|...:
plant   231 GKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAALDGQNLEG--RAIKVNVAEERTR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/75 (31%)
RRM 128..202 CDD:214636 24/73 (33%)
CP31BNP_199836.1 RRM_SF 114..193 CDD:418427 24/78 (31%)
RRM2_NsCP33_like 208..283 CDD:410187 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.