DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and RS40

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001190837.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:240 Identity:63/240 - (26%)
Similarity:96/240 - (40%) Gaps:64/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYE--TRGKRLK 113
            |..|.:|.|||.|:|::        .|..:...:.||....||.|..|:..:|.:|  .:|:||:
plant    12 DAREGDLERLFRKYGKV--------ERVDMKAGFAFVYMEDERDAEDAIRALDRFEFGRKGRRLR 68

  Fly   114 VAFA---------------RPSEYESTSSSLYVGNLPTYMDEKKVREL---FATYGNIVDVNLLR 160
            |.:.               |.|.....|.:|:|.|...  |..:.|:|   |..||.||:|.:  
plant    69 VEWTK
SERGGDKRSGGGSRRSSSSMRPSKTLFVINFDA--DNTRTRDLEKHFEPYGKIVNVRI-- 129

  Fly   161 HKFNNRSRGVAFLQFELVRDAEVAKYGMD-----RYMIEGASRPLTVKFVEREKKGSSSTSSGSQ 220
                  .|..||:|:|...||..|   :|     :.|.:..|....||..:....|.|......:
plant   130 ------RRNFAFIQYEAQEDATRA---LDASNNSKLMDKVISVEYAVKDDDARGNGHSPERRRDR 185

  Fly   221 YKDKRKSSPPPYK------------------RRERTNDHHVSKRS 247
            ..::|:.||.|||                  |:|||:..:..:||
plant   186 SPERRRRSPSPYKRERGSPDYGRGASPVAAYRKERTSPDYGRRRS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 21/67 (31%)
RRM 128..202 CDD:214636 23/81 (28%)
RS40NP_001190837.1 RRM1_AtRSp31_like 2..73 CDD:240680 21/68 (31%)
RRM_SF 98..167 CDD:388407 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.