DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and SR34b

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001328194.1 Gene:SR34b / 828027 AraportID:AT4G02430 Length:292 Species:Arabidopsis thaliana


Alignment Length:95 Identity:37/95 - (38%)
Similarity:56/95 - (58%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 TSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMD 189
            :|.::||||||..:.|::|.:||:.||.:|.::|   |...|..|.||::||..|||:.|.||.|
plant     5 SSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDL---KIPPRPPGYAFVEFEDARDADDAIYGRD 66

  Fly   190 RYMIEGASRPLTVKFVEREKKGSSSTSSGS 219
            .|..:|  ..|.|:.....:: ||..:.||
plant    67 GYDFDG--HHLRVELAHGGRR-SSHDARGS 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 31/73 (42%)
SR34bNP_001328194.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.