DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and RS31

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_567120.1 Gene:RS31 / 825359 AraportID:AT3G61860 Length:264 Species:Arabidopsis thaliana


Alignment Length:198 Identity:52/198 - (26%)
Similarity:85/198 - (42%) Gaps:39/198 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMD----GYETRGKRLKV 114
            :|:|.|||.|:|.:.:..:    ::|    |.||.:..||.|..|:..:|    |||.|  ||.|
plant    15 QSDLERLFDKYGRVDRVDM----KSG----YAFVYFEDERDAEDAIRKLDNFPFGYEKR--RLSV 69

  Fly   115 AFAR------------PSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRS 167
            .:|:            ||..:.|.:...:...|....|..:.:.|..||.:.:|.:        .
plant    70 EWAK
GERGRPRGDAKAPSNLKPTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRI--------R 126

  Fly   168 RGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPY 232
            |..:|:|||...||..|.....|..|  ..|.::|::..::.......:.|   :..|:|..|.|
plant   127 RNFSFVQFETQEDATKALEATQRSKI--LDRVVSVEYALKDDDERDDRNGG---RSPRRSLSPVY 186

  Fly   233 KRR 235
            :||
plant   187 RRR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/66 (35%)
RRM 128..202 CDD:214636 17/73 (23%)
RS31NP_567120.1 RRM_SF 2..73 CDD:418427 23/67 (34%)
RRM2_AtRSp31_like 94..163 CDD:409899 18/78 (23%)
PTZ00449 <138..209 CDD:185628 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.