DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and UBA2A

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001190109.1 Gene:UBA2A / 824853 AraportID:AT3G56860 Length:478 Species:Arabidopsis thaliana


Alignment Length:228 Identity:48/228 - (21%)
Similarity:85/228 - (37%) Gaps:48/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYET 107
            :.::.|..|.....|...|.::|||...|.:..:.:|.|..|||:.|.|...|..|:.  ...:.
plant   142 IFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALK--QPQKK 204

  Fly   108 RGKRL------------------KVAFARPSEY---ESTSSSLYVGNLPTYMDEKKVRELFATYG 151
            .|.|:                  ..|.:.|:::   |.|...:||.|:...:|.:|:...|:.:|
plant   205 IGSRMTACQLASKGPVFGGAPIAAAAVSAPAQHSNSEHTQKKIYVSNVGAELDPQKLLMFFSKFG 269

  Fly   152 NIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTS 216
            .|.:..|...|:..|.:|.....:   :.:|.||..::                |..|     |.
plant   270 EIEEGPLGLDKYTGRPKGFCLFVY---KSSESAKRALE----------------EPHK-----TF 310

  Fly   217 SGS-QYKDKRKSSPPPYKRRERTNDHHVSKRSR 248
            .|. .:..|....|.|.|:::..::.|.....|
plant   311 EGHILHCQKAIDGPKPGKQQQHHHNPHAYNNPR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/91 (22%)
RRM 128..202 CDD:214636 15/73 (21%)
UBA2ANP_001190109.1 PABP-1234 136..>347 CDD:130689 48/228 (21%)
RRM_SF 140..215 CDD:418427 19/74 (26%)
Med15 361..>465 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.