DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and PHIP1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:221 Identity:51/221 - (23%)
Similarity:89/221 - (40%) Gaps:35/221 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSE---RQA 95
            :||     .|.:..:|...||.|:...|...|.|.|.........|......|:.:.:|   ::|
plant   159 VPN-----KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKMRPEDGAFSGIAFITFDTEDGAKRA 218

  Fly    96 AA---AVNGMDGYETRGKRLKVAFARPSEYESTSSS------------LYVGNLPTYMDEKKVRE 145
            .|   |..| |.|.|..:.:|.  ..||.....:||            :|:|||.....|:.:|:
plant   219 LAFDRAAMG-DRYLTIQQYVKT--TTPSIPRRKTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRK 280

  Fly   146 LFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKK 210
            ||:.. .|..|.|.::|.....:|.|.:.|:......:| ..:|:.:|.|  ||:.:....:::.
plant   281 LFSDC-VINSVRLGKNKETGEFKGYAHVDFKDSVSVAIA-LKLDQQVICG--RPVKICCALKDRP 341

  Fly   211 GSSST-----SSGSQYKDKRKSSPPP 231
            .:..|     ::||...:...::..|
plant   342 ATDHTPGETNNAGSYNMEDTYAAADP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/81 (25%)
RRM 128..202 CDD:214636 22/85 (26%)
PHIP1NP_191094.1 RRM <129..327 CDD:223796 43/177 (24%)
RRM1_PHIP1 163..234 CDD:240717 19/71 (27%)
RRM2_PHIP1 263..334 CDD:240718 21/74 (28%)
PTZ00368 393..592 CDD:173561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.