DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and CP29

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:288 Identity:57/288 - (19%)
Similarity:99/288 - (34%) Gaps:103/288 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFQTG---RPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISC 82
            ||..|   .||:.....|:|:    |.:..|..::..::|.:||...|.:...::|..:.||.|.
plant    80 MFADGDDSAPVERNSFSPDLK----LFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSR 140

  Fly    83 CYGFVDYVSERQAAAAVNGMDGYETR---------------------GKRLKV-----------A 115
            .:|||...:..:..||....:||.:|                     |:.|:|           :
plant   141 GFGFVTMSTAAEVEAAAQQFNGYVSRYLCSLLCLYLLIRVLCGLEFEGRPLRVNAGPPPPKREES 205

  Fly   116 FAR----------------------------------------------------PSEYESTSSS 128
            |:|                                                    .|.|.|.|.|
plant   206 FSRGPRSGGYGSERGGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGS 270

  Fly   129 ---------LYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVA 184
                     ||||||...:|:..:..||...|.:|:..::..:.:.||:|..|:.....::.:.|
plant   271 GSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKA 335

  Fly   185 KYGMDRYMIEGASRPLTVKFVE-REKKG 211
            ...::...::|  |.:.|...| |..:|
plant   336 INSLNGADLDG--RQIRVSEAEARPPRG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 21/107 (20%)
RRM 128..202 CDD:214636 19/82 (23%)
CP29NP_001190079.1 RRM_SF 100..194 CDD:302621 20/97 (21%)
RRM_HP0827_like 279..355 CDD:240845 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.