DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and CP33

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:191 Identity:48/191 - (25%)
Similarity:83/191 - (43%) Gaps:18/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYET 107
            |.:..||..:|.|||.::|.:.|.:...:|:..:.|..|..:|||...|..:|..|:...:..:.
plant   118 LYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQI 182

  Fly   108 RGKRLKVAF---ARPSE--------------YESTSSSLYVGNLPTYMDEKKVRELFATYGNIVD 155
            .|:.:||.|   .|..|              |..:...:|.|||...:..:.:::.|.....::.
plant   183 GGRTVKVNFPE
VPRGGENEVMRTKIRDNNRSYVDSPHKVYAGNLGWNLTSQGLKDAFGDQPGVLG 247

  Fly   156 VNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTS 216
            ..::..:...||||..|:.||...:.:.|...|:...:||.:..|.:. .||||...|..|
plant   248 AKVIYERNTGRSRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA-SEREKPTVSPPS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 22/76 (29%)
RRM 128..202 CDD:214636 17/73 (23%)
CP33NP_190806.1 RRM_HP0827_like 117..193 CDD:240845 22/74 (30%)
RRM_SF 220..295 CDD:302621 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.