DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and PSRP2

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001030841.1 Gene:PSRP2 / 824379 AraportID:AT3G52150 Length:253 Species:Arabidopsis thaliana


Alignment Length:176 Identity:39/176 - (22%)
Similarity:77/176 - (43%) Gaps:15/176 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAV 99
            |:......:.:..:|:.:|..:|.:|..:.|.:.|.:::..:.:|.|..:||....|...|.|.|
plant    70 PSSEAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV 134

  Fly   100 NGMDGYETRGKRLKVAF---------------ARPSEYESTSSSLYVGNLPTYMDEKKVRELFAT 149
            ..::|....|:.:||..               :..|.:..:...:|||||...:.::.:..||:.
plant   135 EKLNGNTVEGREIKVNITEKPIASSPDLSVLQSEDSAFVDSPYKVYVGNLAKTVTKEMLENLFSE 199

  Fly   150 YGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEG 195
            .|.:|...:.|....::|.|..|:.|....|.|.|...::..::||
plant   200 KGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 18/90 (20%)
RRM 128..202 CDD:214636 19/68 (28%)
PSRP2NP_001030841.1 RRM_SF 77..154 CDD:327398 18/76 (24%)
RRM <78..>253 CDD:330708 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.