DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and SR34a

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001190041.1 Gene:SR34a / 824105 AraportID:AT3G49430 Length:300 Species:Arabidopsis thaliana


Alignment Length:93 Identity:36/93 - (38%)
Similarity:49/93 - (52%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDR 190
            |.|:||||||..:.|.::.::|..||.|||:.|   |...|.....|::||..||||.|..|.|.
plant     6 SRSIYVGNLPGDIREHEIEDIFYKYGRIVDIEL---KVPPRPPCYCFVEFEHSRDAEDAIKGRDG 67

  Fly   191 YMIEGASRPLTVKFVEREKKGSSSTSSG 218
            |.::|..  |.|:.....:..|||...|
plant    68 YNLDGCR--LRVELAHGGRGQSSSDRRG 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 30/73 (41%)
SR34aNP_001190041.1 RRM_SF 9..79 CDD:418427 30/74 (41%)
RRM2_SF2_plant_like 122..197 CDD:410014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.