DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and NUC-L2

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_188491.1 Gene:NUC-L2 / 821392 AraportID:AT3G18610 Length:636 Species:Arabidopsis thaliana


Alignment Length:229 Identity:52/229 - (22%)
Similarity:92/229 - (40%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYET 107
            |....|...:..|::...|.:.||:...::... ..|....||.:::.|..:|..|:. |:|...
plant   386 LFAGNLSYQIARSDIENFFKEAGEVVDVRLSSF-DDGSFKGYGHIEFASPEEAQKALE-MNGKLL 448

  Fly   108 RGK--RLKVAFARPSEYEST---------SSSLYVGNLPTYMDE----KKVRELFATYGNIVDVN 157
            .|:  ||.:|..|.:...|.         |.::||....:.:.|    |::|..|:..|.:..|:
plant   449 LGRDVRLDLANER
GTPRNSNPGRKGEGSQSRTIYVRGFSSSLGEDEIKKELRSHFSKCGEVTRVH 513

  Fly   158 LLRHKFNNRSRGVAFLQ----FELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSG 218
            :...:....|||.|::.    |:.......::.|.....:| .|||      ....:|.||..:.
plant   514 VPTDRETGASRGFAYIDLTSGFDEALQLSGSEIGGGNIHVE-ESRP------RDSDEGRSSNRAP 571

  Fly   219 SQYKDK-RKSSPPPYKRRERTNDHHVSKRSRDSD 251
            ::...: |.|...|  |..|.:|.  :.|.|.||
plant   572 ARGAPRGRHSDRAP--RGGRFSDR--APRGRHSD 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 18/75 (24%)
RRM 128..202 CDD:214636 18/81 (22%)
NUC-L2NP_188491.1 RRM1_NUCLs 385..461 CDD:409884 18/76 (24%)
RRM2_NUCLs 480..556 CDD:409885 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.