DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT3G15010

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_188119.1 Gene:AT3G15010 / 820730 AraportID:AT3G15010 Length:404 Species:Arabidopsis thaliana


Alignment Length:200 Identity:53/200 - (26%)
Similarity:85/200 - (42%) Gaps:28/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPPLPNLRM-------KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVD 88
            |..|.::|:       :..|.:..|..|.|...|..|||.:|::.:|.:|..:.||.|..||||.
plant    58 PDVLESVRLTADSDISQRKLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVT 122

  Fly    89 YVSERQAAAAV----NGMDGYETRGKRLKVAFARPSEYESTSS--------SLYVGNLPTYMDEK 141
            ::....|..|:    ..:||      |:.|.....|..:.|.|        .:||.|:|..|...
plant   123 FMHVDGALLALKEPSKKIDG------RVTVTQLAASGNQGTGSQIADISMRKIYVANVPFDMPAD 181

  Fly   142 KVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVE 206
            ::...|..||::.:..|...|...:|||.|...::....|:.|.....: :|:|  :.|..|...
plant   182 RLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVK-VIDG--KHLNCKLAV 243

  Fly   207 REKKG 211
            ..|||
plant   244 DGKKG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 24/79 (30%)
RRM 128..202 CDD:214636 19/73 (26%)
AT3G15010NP_188119.1 RRM_SF 75..150 CDD:418427 24/80 (30%)
RRM2_NsCP33_like 168..242 CDD:410187 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.