DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and SCL30A

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_187966.1 Gene:SCL30A / 820559 AraportID:AT3G13570 Length:262 Species:Arabidopsis thaliana


Alignment Length:162 Identity:51/162 - (31%)
Similarity:78/162 - (48%) Gaps:29/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GYETRGK----RLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFN 164
            ||..||:    |.:...:|.|:   ..:||.|.||.....::.:|..|..:|.:.|:.|.|..:.
plant    13 GYGRRGRSPSPRGRFGGSRDSD---LPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYT 74

  Fly   165 NRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSS------GSQYKD 223
            ...||..|:||....||..||:.||.|::.|  |.|||.|.|..:|..:...:      .::::|
plant    75 GDPRGFGFIQFMDPADAAEAKHQMDGYLLLG--RELTVVFAEENRKKPTEMRTRDRGGRSNRFQD 137

  Fly   224 KRKS------SPPPYK-RRERTNDHHVSKRSR 248
            :|:|      ||||.: ||.|:       |||
plant   138 RRRSPPRYSRSPPPRRGRRSRS-------RSR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 5/16 (31%)
RRM 128..202 CDD:214636 26/73 (36%)
SCL30ANP_187966.1 RRM <36..225 CDD:223796 44/136 (32%)
RRM_SF 37..120 CDD:388407 31/84 (37%)
DUF2457 <196..>262 CDD:371058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.