DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and RS31a

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_182184.1 Gene:RS31a / 819273 AraportID:AT2G46610 Length:250 Species:Arabidopsis thaliana


Alignment Length:240 Identity:65/240 - (27%)
Similarity:101/240 - (42%) Gaps:65/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMD----GYETRGKR 111
            |...|:|.|||||||.:::..:    ::|    |.||.:..||.|..|:...|    ||..|  :
plant    12 DTRHSDLERLFSKFGRVKRVDM----KSG----YAFVYFEDERDAEDAIRRTDNTTFGYGRR--K 66

  Fly   112 LKVAFA--------RPSEYESTSS-----SLYVGNL-PTYMDEKKVRELFATYGNIVDVNLLRHK 162
            |.|.:|        :|.:.::.|:     :|:|.|. |....|:.:...|..||.:::|.:    
plant    67 LSVEWAK
DFQGERGKPRDGKAVSNQRPTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRM---- 127

  Fly   163 FNNRSRGVAFLQFELVRDAEVA----------------KYGM-------DRYMIEGASRPLTVKF 204
                .|..||:||....||..|                :|.:       |||  .|:.|..:...
plant   128 ----RRNFAFVQFATQEDATKALDSTHNSKLLDKVVSVEYALREAGEREDRY--AGSRRRRSPSP 186

  Fly   205 VEREKKGSSSTSSGSQYKDKRKSSPPPYKRRERTNDHHVSKRSRD 249
            |.|.:.....|...|...|:.| .|.||:|| ::.|:  .:||.|
plant   187 VYRRRPSPDYTRRRSPEYDRYK-GPAPYERR-KSPDY--GRRSSD 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 24/69 (35%)
RRM 128..202 CDD:214636 23/97 (24%)
RS31aNP_182184.1 RRM_SF 2..73 CDD:302621 24/70 (34%)
RRM_SF 96..165 CDD:302621 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.