DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT2G37220

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:203 Identity:49/203 - (24%)
Similarity:89/203 - (43%) Gaps:29/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQA 95
            ||...:......|.:..||.::..::|.:||...|.:...::|..:.||.|..:|||...|..:.
plant    81 PPKEQSFSADLKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEV 145

  Fly    96 AAAVNGMDGYETRGKRLKVAFARP-------------SEYESTSSS--------------LYVGN 133
            .||....:|||..|:.|:|....|             |.:.|:.|.              :||||
plant   146 EAAAQQFNGYELDGRPLRVNAGPPPPKREDGFSRGPRSSFGSSGSGYGGGGGSGAGSGNRVYVGN 210

  Fly   134 LPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASR 198
            |...:|:..:..||:..|.:|:..::..:.:.||:|..|:.::..::.:.|...:|...::|  |
plant   211 LSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDG--R 273

  Fly   199 PLTVKFVE 206
            .:.|...|
plant   274 QIRVSEAE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/75 (31%)
RRM 128..202 CDD:214636 18/87 (21%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:418427 23/77 (30%)
RRM2_NsCP33_like 205..280 CDD:410187 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.