DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT2G35410

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:216 Identity:60/216 - (27%)
Similarity:98/216 - (45%) Gaps:27/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVN 100
            |..:|..|.:..||..|:.:::..||.:.|.:...:||| ::.|.:..:.||...|..:|.||::
plant    90 NSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIR-QKDGKNRGFAFVTMASGEEAQAAID 153

  Fly   101 GMDGYETRGKRLKVAFAR---------PSEYES-----TSSSLYVGNLPTYMDEKKVRELF-ATY 150
            ..|.::..|:.:.|:|||         |::..|     |...|||.||........:|||| |..
plant   154 KFDTFQVSGRIISVSFARRFKKPTPKSPNDLPSPAPGDTRHKLYVSNLAWKARSTHLRELFTAAD 218

  Fly   151 GNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREK------ 209
            .|.|...::......||.|..|:.|....:||.|...::...|.|  ||:|:||..|..      
plant   219 FNPVSARVVFADPEGRSSGYGFVSFATREEAENAITKLNGKEIMG--RPITLKFSLRSASESEDG 281

  Fly   210 ---KGSSSTSSGSQYKDKRKS 227
               :.::::..|...:||..|
plant   282 DSVEANNASEDGDTVEDKNTS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/75 (27%)
RRM 128..202 CDD:214636 24/74 (32%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 54/184 (29%)
RRM_SF 97..168 CDD:409669 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.