DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT2G22100

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_565526.1 Gene:AT2G22100 / 816745 AraportID:AT2G22100 Length:382 Species:Arabidopsis thaliana


Alignment Length:90 Identity:20/90 - (22%)
Similarity:44/90 - (48%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 YET--RGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRS 167
            |:|  :|.:|..|....::.:|:..:::|..|......:.::..|..||.|.:.:::..|...|:
plant   139 YKTAEKGSKLISAVFESADRDSSQRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRA 203

  Fly   168 RGVAFLQFELVRDAEVAKYGMDRYM 192
            :|..|:.|:..:.|..|....::.|
plant   204 KGFGFVLFKTRKGARAALKNPEKRM 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 5/13 (38%)
RRM 128..202 CDD:214636 14/65 (22%)
AT2G22100NP_565526.1 PABP-1234 <164..>353 CDD:130689 14/65 (22%)
RRM_SF 165..235 CDD:418427 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.