DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Celf3

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001276542.1 Gene:Celf3 / 78784 MGIID:1926034 Length:494 Species:Mus musculus


Alignment Length:171 Identity:46/171 - (26%)
Similarity:86/171 - (50%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYET 107
            |.:..:|:.:.|.:|..:|.:||.|.:..:|:.:.||:.....|:.|.:...|..|.:.:...:|
Mouse     9 LFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKT 73

  Fly   108 RGKRLKVAFARPSEYESTSS--SLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGV 170
            .....:....:|::.||...  .|:||.|.....::.||::|..:|.|.:..:||.. :..|:|.
Mouse    74 LPGMNRPIQVKPADS
ESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGP-DGTSKGC 137

  Fly   171 AFLQFELVRDAEVAKYGM-DRYMIEGASRPLTVKFVEREKK 210
            ||::|:...:|:.|...: ....:.|||..|.|||.:.||:
Mouse   138 AFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 16/73 (22%)
RRM 128..202 CDD:214636 22/74 (30%)
Celf3NP_001276542.1 RRM1_CELF3_4_5_6 2..88 CDD:410041 17/78 (22%)
RRM2_CELF3_4_5_6 94..174 CDD:410043 25/80 (31%)
PRK12323 <214..379 CDD:237057
RRM3_CELF3_4_5_6 405..483 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.