DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpa3

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001315077.1 Gene:hnrnpa3 / 751729 ZFINID:ZDB-GENE-060224-1 Length:340 Species:Danio rerio


Alignment Length:142 Identity:39/142 - (27%)
Similarity:65/142 - (45%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDY--VSERQAA--AAVNGMD 103
            |.:..|..:.||..|...|.::|::....::|......|..:|||.|  |||..||  |..:.:|
Zfish    15 LFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVD 79

  Fly   104 GYETRGKRLKVAFARPSEYES----TSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFN 164
            |.....||   |.:|....:.    |...::||.:....:|..:||.|..||.|..::::..:..
Zfish    80 GRVVEPKR---AVSR
EDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERST 141

  Fly   165 NRSRGVAFLQFE 176
            .:.||..|:.|:
Zfish   142 GKKRGFCFVTFD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 24/77 (31%)
RRM 128..202 CDD:214636 13/49 (27%)
hnrnpa3NP_001315077.1 RRM1_hnRNPA_like 14..91 CDD:241022 24/78 (31%)
RRM2_hnRNPA3 104..183 CDD:241026 13/50 (26%)
HnRNPA1 <296..>315 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.