DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Rbm31y

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_083246.1 Gene:Rbm31y / 74484 MGIID:1921734 Length:565 Species:Mus musculus


Alignment Length:209 Identity:51/209 - (24%)
Similarity:91/209 - (43%) Gaps:6/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGF 86
            |:.|..:|   ...|.:..:.:.:..|.|:|::..|....||||||....|.....||:|..:||
Mouse    17 FREGFKID---ATKNQQDASKMFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGF 78

  Fly    87 VDYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYG 151
            |.:.........:...| ::..||:::...|:..|.:..:..::||.|...:.|:|:|..|.|:|
Mouse    79 VLFKDSATVEKVLQVKD-HKVDGKKIEFKRAKALESQFPNKKIFVGGLNPRLSEEKIRAYFGTFG 142

  Fly   152 NIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTS 216
            .|..:.|.........|...|:::  :.:..|.|...:||...|:||........:|......:.
Mouse   143 QIEAIELPLCSDTRERRAFGFIKY--MDENSVRKVLENRYHFIGSSRCEVKMAYPKENPARQLSK 205

  Fly   217 SGSQYKDKRKSSPP 230
            ..:..||:.:.|.|
Mouse   206 RKAIAKDRTRKSVP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/75 (27%)
RRM 128..202 CDD:214636 20/73 (27%)
Rbm31yNP_083246.1 RRM_SF 35..108 CDD:302621 20/73 (27%)
RRM_SF 119..193 CDD:302621 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.