DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpab

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_012814656.1 Gene:hnrnpab / 734098 XenbaseID:XB-GENE-6042555 Length:326 Species:Xenopus tropicalis


Alignment Length:230 Identity:59/230 - (25%)
Similarity:97/230 - (42%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ESSVPTLCWGYAG-----IRGMFQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKF 64
            ||.||....|..|     .:|....|...|...||..   ...:.:..|..|.::.:|...||||
 Frog    27 ESKVPGGQNGAEGDQINASKGEEDAGCVPDISSPLTE---GVKMFVGGLSWDTSKKDLKDYFSKF 88

  Fly    65 GEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETR--GKRL--KVAFARPSEYEST 125
            ||:....|.....||.|..:||:.:   :.||:....::..|.|  |:.:  |.|.|...:   .
 Frog    89 GEVSDCTIKMDPNTGRSRGFGFILF---KDAASVDKVLEQKEHRLDGRLIDPKKAMAMKKD---P 147

  Fly   126 SSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDR 190
            ...::||.|.....|.|:||.|.|:|.|..:.|......|:.||..|:.|   ::.|..|..:::
 Frog   148 IKKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITF---KEEEPVKKILEK 209

  Fly   191 --YMIEGASRPLTV---KFVEREKKGSSSTSSGSQ 220
              :.:.|:...:.:   |.|.:::.|....|.|.:
 Frog   210 KFHNVSGSKCEIKIAQPKEVYQQQYGGRGGSFGGR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 22/79 (28%)
RRM 128..202 CDD:214636 20/75 (27%)
hnrnpabXP_012814656.1 CBFNT 1..52 CDD:311868 7/24 (29%)
RRM1_hnRNPAB 66..140 CDD:241201 21/76 (28%)
RRM2_hnRNPAB 145..224 CDD:241028 20/84 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.