DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and SRSF1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_008855.1 Gene:SRSF1 / 6426 HGNCID:10780 Length:248 Species:Homo sapiens


Alignment Length:243 Identity:55/243 - (22%)
Similarity:87/243 - (35%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRL 112
            ||.|:...::..:|.|:|.||... :::||.|..  :.||::...|.|..||.|.|||:..|.||
Human    23 LPPDIRTKDIEDVFYKYGAIRDID-LKNRRGGPP--FAFVEFEDPRDAEDAVYGRDGYDYDGYRL 84

  Fly   113 KVAFAR------------------------PSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNI 153
            :|.|.|                        ||  ..:.:.:.|..||.....:.:::.....|::
Human    85 RVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPS--RRSENRVVVSGLPPSGSWQDLKDHMREAGDV 147

  Fly   154 VDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMD--------------RYMIEGASRP----L 200
            ...::.|.       |...::|....|...|...:|              |..::|...|    .
Human   148 CYADVYRD-------GTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRS 205

  Fly   201 TVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKRRERTNDHHVSKRSR 248
            ..:...|.:..|.|.|....|..:|....|.|..|      |...|||
Human   206 RSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR------HSRSRSR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 25/68 (37%)
RRM 128..202 CDD:214636 13/91 (14%)
SRSF1NP_008855.1 RRM1_SRSF1 12..90 CDD:410010 26/69 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 7/47 (15%)
RRM2_SRSF1 113..196 CDD:410160 13/91 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248 16/63 (25%)
Interaction with SAFB1 198..247 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.