DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpd

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001025523.1 Gene:hnrnpd / 594903 XenbaseID:XB-GENE-988375 Length:295 Species:Xenopus tropicalis


Alignment Length:187 Identity:49/187 - (26%)
Similarity:83/187 - (44%) Gaps:14/187 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYET 107
            :.:..|..|.|:.:|...||||||:....:.....||.|..:|||.: .|.:....|.....::.
 Frog    40 MFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLF-KESEGVDKVMEQKEHKL 103

  Fly   108 RGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAF 172
            .||.:....|:..:.:.....::||.|.....|:|:||.|.|:|.|..:.|......|:.||..|
 Frog   104 NGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGTFGEIEAIELPMDNKTNKRRGFCF 168

  Fly   173 LQFELVRDAEVAKYGMDRYMIEGASR-----PLTVKFVEREKK------GSSSTSSG 218
            :.|:  .:..|.|....:|...|.|:     .|:.:..:::::      ||||...|
 Frog   169 ITFK--EEDPVKKIMEKKYHNVGLSKCEIKVALSKEQYQQQQQWGTRGGGSSSRPRG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/73 (27%)
RRM 128..202 CDD:214636 23/78 (29%)
hnrnpdNP_001025523.1 RRM1_hnRNPD 40..113 CDD:241200 20/73 (27%)
RRM2_hnRNPD 124..198 CDD:241027 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.