DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpd

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:143 Identity:39/143 - (27%)
Similarity:66/143 - (46%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRL 112
            |..|.|:.:|...|:||||:....:.....||.|..:|||.: .|.::...|.....::..||.:
Zfish    61 LSWDTTKKDLKDYFTKFGEVVDCTLKLDPLTGRSRGFGFVLF-KEAESVEKVITQKEHKLNGKVI 124

  Fly   113 KVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFEL 177
            ....|:..:.:.....::||.|.....|:|:||.|..||.:..:.|......|:.||..|:.|  
Zfish   125 DPKKA
KAMKTKEPVKKIFVGGLSPDTPEEKIREYFDAYGEVESIELPMENKTNKRRGFCFITF-- 187

  Fly   178 VRDAEVAKYGMDR 190
             ::.|..|..|::
Zfish   188 -KEEEPVKKIMEK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/68 (28%)
RRM 128..202 CDD:214636 19/63 (30%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369
RRM1_hnRNPD_like 56..129 CDD:241019 19/68 (28%)
RRM2_hnRNPD 140..214 CDD:241027 19/63 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.