DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpa2b1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001192271.1 Gene:hnrnpa2b1 / 549680 XenbaseID:XB-GENE-490993 Length:350 Species:Xenopus tropicalis


Alignment Length:189 Identity:46/189 - (24%)
Similarity:85/189 - (44%) Gaps:14/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVS----ERQAAAAVNGMD 103
            |.:..|..:.||..|...:.::|::....::|...:..|..:|||.:.|    :...||..:.:|
 Frog    11 LFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTID 75

  Fly   104 GYETRGKR--LKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNR 166
            |.....||  .:...|:|..: .|...|:||.:....:|..:||.|..||.|..:.::..|.:.:
 Frog    76 GRVVEPKRAVAR
EESAKPGAH-VTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGK 139

  Fly   167 SRGVAFLQFELVRDAE-VAKYGMDRY-MIEGASRPLTVKFVEREKKGSSST--SSGSQY 221
            .||..|:.|:   |.: |.|..:.:| .|.|.:..:.....::|.:...:|  |.|..:
 Frog   140 KRGFGFVTFD---DHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQNTRNSRGGNF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 18/79 (23%)
RRM 128..202 CDD:214636 21/75 (28%)
hnrnpa2b1NP_001192271.1 RRM1_hnRNPA2B1 7..87 CDD:241206 18/75 (24%)
RRM2_hnRNPA2B1 100..179 CDD:241025 21/81 (26%)
HnRNPA1 294..319 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.