DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Hnrnpdl

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_057899.2 Gene:Hnrnpdl / 50926 MGIID:1355299 Length:420 Species:Mus musculus


Alignment Length:186 Identity:42/186 - (22%)
Similarity:84/186 - (45%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAA--VNGMDGY 105
            :.:..|..|.::.:|....|:|||:....|.....||.|..:|||.:   :.||:.  |..:..:
Mouse   150 MFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLF---KDAASVDKVLELKEH 211

  Fly   106 ETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGV 170
            :..||.:....|:..:.:.....::||.|.....|::::|.|..:|.|.::.|......|..||.
Mouse   212 KLDGKLIDPKRAK
ALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGF 276

  Fly   171 AFLQF---ELVRDAEVAKY---GMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQ 220
            .|:.:   |.|:....::|   |..:..|:.|......:..::::||....::|.:
Mouse   277 CFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/75 (25%)
RRM 128..202 CDD:214636 19/79 (24%)
HnrnpdlNP_057899.2 RRM1_hnRPDL 149..224 CDD:241202 19/76 (25%)
RRM2_hnRPDL 234..308 CDD:241029 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.