DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AT5G03495

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001078524.1 Gene:AT5G03495 / 5008197 AraportID:AT5G03495 Length:226 Species:Arabidopsis thaliana


Alignment Length:184 Identity:36/184 - (19%)
Similarity:68/184 - (36%) Gaps:42/184 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSE--RQAAAAVNGMD--GYETRGKRLKVAFA 117
            |.:.|:..|:|....:.|....||.....|:....|  .:.|..::|.|  |:        .|..
plant    49 LEKHFASCGKITHIYVPRDFERGILKSVAFMCIKGEGGEEKALLLSGTDAGGW--------TAIV 105

  Fly   118 RPSEYESTSSSLYVGNLPTYMDEKKVR------------------ELFATYGNIVDVNLLRHKFN 164
            :|:.::......::..:|. ::..:||                  |.|::.|.:..|.:|     
plant   106 KPALWQKEIMDPWLPGMPK-LETHRVRVTGYDTCVPKIDIQMALCEHFSSCGEVTQVVVL----- 164

  Fly   165 NRSRGVAFLQFELVRDAEV----AKYGMDRYMIEGASRPLTVKFVEREKKGSSS 214
            ....|..:||.|...|..:    .|.|....::|  |..:..:.:::||...||
plant   165 PSGSGSIYLQGERCEDKALQLNGCKMGGMNLVVE--SVLIEPEDLKKEKGAPSS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 14/63 (22%)
RRM 128..202 CDD:214636 17/95 (18%)
AT5G03495NP_001078524.1 RRM_SF 30..108 CDD:302621 14/66 (21%)
RRM_SF 132..198 CDD:302621 12/70 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.