DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maca and Srsf2

DIOPT Version :10

Sequence 1:NP_650473.1 Gene:maca / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001009720.1 Gene:Srsf2 / 494445 RGDID:1359422 Length:221 Species:Rattus norvegicus


Alignment Length:231 Identity:60/231 - (25%)
Similarity:89/231 - (38%) Gaps:43/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQ 94
            |||.:..:   |:|.::.|....:...|.|:|.|:|.:....|.|.|.|..|..:.||.:..:|.
  Rat     6 PPPDVEGM---TSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRD 67

  Fly    95 AAAAVNGMDGYETRGKRLKVAFAR----PSEYESTSS---SLYVGNLPTYMDEKKVRELFATYGN 152
            |..|::.|||....|:.|:|..||    |..:.|...   ..|.|               ..||.
  Rat    68 AEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGG---------------GGYGR 117

  Fly   153 IVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKY--GMDRYMIEGASRPLTVKFVEREKKGSSST 215
            .......|.:..:|||..:       |....::|  ...|......||..:.....|..|..||:
  Rat   118 RSRSPRRRRRSRSRSRSRS-------RSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSS 175

  Fly   216 SSGSQYKDKRKS---SPPPYKRRERTNDHHVSKRSR 248
            .|.|:.:.:.:|   ||||..:||.      ..|||
  Rat   176 VSRSRSRSRSRSRSRSPPPVSKRES------KSRSR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
macaNP_650473.1 sex-lethal <41..>210 CDD:273740 42/177 (24%)
Srsf2NP_001009720.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 22/71 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 31/142 (22%)

Return to query results.
Submit another query.