DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and tra2b

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001006878.1 Gene:tra2b / 448667 XenbaseID:XB-GENE-5864557 Length:293 Species:Xenopus tropicalis


Alignment Length:166 Identity:45/166 - (27%)
Similarity:66/166 - (39%) Gaps:49/166 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMI 193
            |.|..|..|..|:.:||:|:.||.|.||:::..:.:.||||.:|:.||.|.||:.||...:...:
 Frog   124 LGVFGLSLYTTERDLREVFSKYGPISDVSIVYDQQSRRSRGFSFVYFENVDDAKEAKERANGMEL 188

  Fly   194 EG---------ASRPLTVK---FVEREKKGSSSTSS----------------------------- 217
            :|         ..||.|..   ::.|...|||....                             
 Frog   189 DGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGGYDDREYYSRSYRGGGGGGG 253

  Fly   218 ---GSQYKDK--RKSSPPPYKRRERTNDHHVSKRSR 248
               |.|.:|:  |:.||.||..|   ..:....|||
 Frog   254 GWRGGQDRDQFSRRRSPSPYYSR---GSYRSRSRSR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 28/81 (35%)
tra2bNP_001006878.1 RRM_SF 113..201 CDD:388407 26/76 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.