DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and trv

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:200 Identity:48/200 - (24%)
Similarity:85/200 - (42%) Gaps:48/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPP---------------------LPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIR 74
            |||                     :|.|..:.::.:..|..::...:|...|:.||||...:::|
  Fly   281 PPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVR 345

  Fly    75 HRRTGISCCYGFVDYVSERQAAAAVNGMDG--YETRGKRLKVAFARP-------------SEYES 124
            ..:|..|..||||.::.:.:|.:|:..|:|  ..:|..|...|..:|             ..|..
  Fly   346 DPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQ 410

  Fly   125 TSSS---LYVGNLP---TYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEV 183
            :|.|   :|||.:.   |.:.|:.:::.||.||.|.::.:.:.|      |.||::|.....|..
  Fly   411 SSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDK------GYAFVRFSTKEAATH 469

  Fly   184 AKYGM 188
            |..|:
  Fly   470 AIVGV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 21/77 (27%)
RRM 128..202 CDD:214636 19/66 (29%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 20/73 (27%)
RRM3_TIA1_like 416..491 CDD:240800 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.