DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpabb

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_998467.1 Gene:hnrnpabb / 406594 ZFINID:ZDB-GENE-040426-2516 Length:309 Species:Danio rerio


Alignment Length:134 Identity:38/134 - (28%)
Similarity:60/134 - (44%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFV-----DYVSERQAAAAVNGMDGYET 107
            |..|.::.:|...||||||:....|.....||.|..:||:     |.| :|......:.:||.:.
Zfish    52 LSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSV-DRVLQQKEHRLDGRQI 115

  Fly   108 RGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAF 172
            ..||.......|.:      .::||.|.....|:|:||.|.::|.|..:.|......::.||..|
Zfish   116 DPKRA
MAIKKEPVK------KIFVGGLNPETTEEKIREYFGSFGEIETIELPTDPKTSKRRGFVF 174

  Fly   173 LQFE 176
            :.|:
Zfish   175 ITFK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 22/73 (30%)
RRM 128..202 CDD:214636 15/49 (31%)
hnrnpabbNP_998467.1 CBFNT 2..45 CDD:285369
RRM1_hnRNPAB 46..120 CDD:241201 21/68 (31%)
RRM_SF 125..204 CDD:302621 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.