DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and srsf9

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001299828.1 Gene:srsf9 / 405835 ZFINID:ZDB-GENE-040426-2397 Length:245 Species:Danio rerio


Alignment Length:109 Identity:38/109 - (34%)
Similarity:52/109 - (47%) Gaps:7/109 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSR-GVAFLQFELVRDAEVAKYGMDRYM 192
            :||||||..:.|:.:.:||..||.|.|:.|.    ||||. ..||::||..||||.|.:|.:.|.
Zfish     6 IYVGNLPMDVQERDIEDLFFKYGKIRDIELK----NNRSTIPFAFVRFEDPRDAEDAVFGRNGYG 66

  Fly   193 IEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKRRE 236
            .....  |.|::........|..:.|......|....||.:|.|
Zfish    67 FGDCK--LRVEYPRSSGSKFSGPAGGGGGGGPRGRFGPPTRRSE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 30/73 (41%)
srsf9NP_001299828.1 RRM <1..>76 CDD:223796 31/75 (41%)
RRM1_SRSF9 5..76 CDD:241042 31/75 (41%)
RRM_SF 109..184 CDD:302621 38/109 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.