DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and cocoon

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:178 Identity:45/178 - (25%)
Similarity:81/178 - (45%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPNLRMKT----------NLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFV- 87
            |.|...||          :||:..|..:.||.:|...|..:|::.||:|.:..|:|.|..:||| 
  Fly    90 LENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVR 154

  Fly    88 --DYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATY 150
              .|..:....:..:.:||   |...:||..:|....:. ...::||.....::...:||.|:.:
  Fly   155 FGSYDVQMHVLSKRHSIDG---RWCEVKVPASRGMGNQE-PGKVFVGRCTEDIEADDLREYFSKF 215

  Fly   151 GNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGM-DRYMIEGAS 197
            |.::|| .:...|    |..:|:.|   .|..|.:... ::::|:|.|
  Fly   216 GEVIDV-FIPKPF----RAFSFVTF---LDPYVPRVVCGEKHIIKGVS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 24/88 (27%)
RRM 128..202 CDD:214636 17/71 (24%)
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 23/78 (29%)
RRM2_TDP43 193..262 CDD:240768 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.