DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpa0

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_988923.1 Gene:hnrnpa0 / 394519 XenbaseID:XB-GENE-1000573 Length:309 Species:Xenopus tropicalis


Alignment Length:189 Identity:52/189 - (27%)
Similarity:86/189 - (45%) Gaps:17/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNG----MD 103
            |.:..|....||..|.:.|..:|::....::.:.:|..|.|:|||.|.|..:|.|||..    :|
 Frog    14 LFIGGLNVQTTEEGLRQHFETYGQLTDCVVVINPQTKRSRCFGFVTYSSAAEADAAVEASPHVVD 78

  Fly   104 GYETRGKRL--KVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNR 166
            |.....||.  :...|:|..:... ..|:||.|...:.|..:.|.||.:|.:..|.::..|.:.:
 Frog    79 GNNVELKRAV
SREDSAKPGAHAKV-KKLFVGGLKEDVGESDLLEHFAQFGAVEKVEIIADKVSGK 142

  Fly   167 SRGVAFLQF---ELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREK--KGSSSTSSGSQ 220
            .||..|:.|   :....|.|.|:    :.|.| .|....|.|.:|:  :||:.:..|.:
 Frog   143 KRGFGFVYFTNHDSADKAAVVKF----HSING-HRVEVKKAVPKEELSQGSNRSFRGGR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/79 (29%)
RRM 128..202 CDD:214636 21/76 (28%)
hnrnpa0NP_988923.1 RRM1_hnRNPA0 10..88 CDD:240772 23/73 (32%)
RRM2_hnRNPA0 104..183 CDD:241023 23/83 (28%)
HnRNPA1 255..>275 CDD:314495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.