DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and srsf10b

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_956827.1 Gene:srsf10b / 393505 ZFINID:ZDB-GENE-040426-1415 Length:248 Species:Danio rerio


Alignment Length:164 Identity:52/164 - (31%)
Similarity:80/164 - (48%) Gaps:36/164 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRD 180
            :.||     .:|||:|.|:......:.:|..|..||.||||.:....::.|.||.|::|||.|||
Zfish     4 YMRP-----PNSSLFVRNISDESRPEDLRREFGRYGPIVDVYIPLDFYSRRPRGFAYIQFEDVRD 63

  Fly   181 AEVAKYGMDRYMIEGASRPLTVKFVEREKK-------GSSSTSSGSQYK-------------DKR 225
            ||.|.:.:||..:.|  |.:.::|.:.::|       ...|:...|:|:             |:|
Zfish    64 AEDALHNLDRKWVCG--RQIEIQFAQGDRKTPGQMKNKERSSPRSSRYEDSDRRRRSRSRSYDRR 126

  Fly   226 KSSPPPYKRRERTNDH--------HVSKRSRDSD 251
            :|..|.|.||.|.:|.        | |:|||:.|
Zfish   127 RSRSPSYDRRRRRSDSPRESRGRTH-SRRSREHD 159

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity