DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and bol

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster


Alignment Length:159 Identity:40/159 - (25%)
Similarity:69/159 - (43%) Gaps:46/159 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPP--------------------LPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRH 75
            |||                    :||     .:.:..:..|.||::|.|:||.:|.::..|||..
  Fly     8 PPPSATPGGGLETPLAAPKYGTLIPN-----RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD 67

  Fly    76 RRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRLKVAFA---RPSEYES---TSSSLY---- 130
             |.|:|..||||.:.:|::|.......:....|.::|.:|.|   :|:..:|   |:.::|    
  Fly    68 -RAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTT 131

  Fly   131 ----VGNLPTYMDEKKVRELFATYGNIVD 155
                :.|:|  ||:...    |.|..:.|
  Fly   132 PPAPISNIP--MDQFAA----AVYPPVTD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/75 (31%)
RRM 128..202 CDD:214636 8/36 (22%)
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.