DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maca and CG1316

DIOPT Version :10

Sequence 1:NP_650473.1 Gene:maca / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster


Alignment Length:224 Identity:58/224 - (25%)
Similarity:91/224 - (40%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSER 93
            |..||:..|.:..|       :..||.:....||.:|||....:::.:.|..:....:|.:....
  Fly    22 DDDPPMSRLFIICN-------KAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTS 79

  Fly    94 QAAAAVNGMDGYETRGK---RLKVAFARPSEYESTSSS--------LYVGNLPTYMDEKKVRELF 147
            .||.|...|:| :|.||   .|||..|......|..|.        |:: .:|....|:.:||.|
  Fly    80 DAAKAQEEMNG-KTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFI-VIPKTATEEDIREEF 142

  Fly   148 ATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGS 212
            :.:|::..|.:::.|.|...:|..:::|.....|.||        .|..|  ...|.|..|.|||
  Fly   143 SQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVA--------FENCS--AKYKAVFAEPKGS 197

  Fly   213 SSTSSGSQYKDKRKSSPPPYKRRERTNDH 241
            :.|.. .|| .:.....|.|....|.|.:
  Fly   198 TRTQR-DQY-GRPSEDNPLYSSSGRGNSN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
macaNP_650473.1 sex-lethal <41..>210 CDD:273740 44/179 (25%)
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:409801 24/87 (28%)
RRM_SF 122..195 CDD:473069 20/83 (24%)
RRM3_RBM45 267..339 CDD:409803
RRM4_RBM45 383..449 CDD:409804
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.