DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and CG1316

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster


Alignment Length:224 Identity:58/224 - (25%)
Similarity:91/224 - (40%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSER 93
            |..||:..|.:..|       :..||.:....||.:|||....:::.:.|..:....:|.:....
  Fly    22 DDDPPMSRLFIICN-------KAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTS 79

  Fly    94 QAAAAVNGMDGYETRGK---RLKVAFARPSEYESTSSS--------LYVGNLPTYMDEKKVRELF 147
            .||.|...|:| :|.||   .|||..|......|..|.        |:: .:|....|:.:||.|
  Fly    80 DAAKAQEEMNG-KTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFI-VIPKTATEEDIREEF 142

  Fly   148 ATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGS 212
            :.:|::..|.:::.|.|...:|..:::|.....|.||        .|..|  ...|.|..|.|||
  Fly   143 SQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVA--------FENCS--AKYKAVFAEPKGS 197

  Fly   213 SSTSSGSQYKDKRKSSPPPYKRRERTNDH 241
            :.|.. .|| .:.....|.|....|.|.:
  Fly   198 TRTQR-DQY-GRPSEDNPLYSSSGRGNSN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 21/78 (27%)
RRM 128..202 CDD:214636 17/81 (21%)
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 24/87 (28%)
RRM2_RBM45 122..195 CDD:240813 20/83 (24%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.