DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and CG4612

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:151 Identity:43/151 - (28%)
Similarity:69/151 - (45%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYET 107
            :.:..|.:.:....::..||.||.|....:.:. ..|.|..||||.:.||..|.||:..::|...
  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178

  Fly   108 RGKRLKVAF---ARPSEYESTS--SSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRS 167
            ..:::.|..   .|..|.|..:  .:|||.||.....|:.:||:|..||.|....|:..: ..||
  Fly   179 NNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRS 242

  Fly   168 RGVAFLQFELVRDAEVAKYGM 188
            |...|:.:|..:.|..|..|:
  Fly   243 RRFGFVAYENPQSALAAVIGL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/76 (25%)
RRM 128..202 CDD:214636 21/61 (34%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/70 (26%)
RRM3_I_PABPs 202..282 CDD:240826 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.