DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and RBMY1B

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001006121.1 Gene:RBMY1B / 378948 HGNCID:23914 Length:496 Species:Homo sapiens


Alignment Length:110 Identity:34/110 - (30%)
Similarity:57/110 - (51%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMI 193
            |::|.|....:||.::.:|..:|.|.:|.|::.: .::|||.||:.||...||:.|...|:...:
Human    10 LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNAAKDMNGKSL 73

  Fly   194 EGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKRRERT 238
            .|.:    :| ||:.||  .|..||.:.:       ||...|.|:
Human    74 HGKA----IK-VEQAKK--PSFQSGGRRR-------PPASSRNRS 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 22/72 (31%)
RBMY1BNP_001006121.1 RRM <1..189 CDD:223796 34/110 (31%)
RRM_RBMX_like 7..85 CDD:240828 25/80 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..349 14/52 (27%)
RBM1CTR 174..218 CDD:285341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.