DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpa1b

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_956398.1 Gene:hnrnpa1b / 378453 ZFINID:ZDB-GENE-030912-14 Length:422 Species:Danio rerio


Alignment Length:183 Identity:47/183 - (25%)
Similarity:84/183 - (45%) Gaps:27/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYG 85
            |.:.|:|.:|    ..||   .|.:..|..:.|:..|...|.::|.:....:::...|..|..:|
Zfish    20 MSKEGQPREP----EQLR---KLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMKDPNTKRSRGFG 77

  Fly    86 FVDYVSERQAAAAVNG----MDGYETRGKRLKVAFARPSEYE----STSSSLYVGNLPTYMDEKK 142
            ||.|.|..:..|:::.    :||.....||   |.:|....:    :|...::||.:....:|..
Zfish    78 FVTYSSVDEVNASMDARPHKVDGRLVEPKR---AVSREDSSKPFAHTTVKKIFVGGIKDDTEENH 139

  Fly   143 VRELFATYGNIVDVNLL-RHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIE 194
            :|:.|..:|.|..|.:: .||..|: ||.||:.|:   |.:    .:||.:|:
Zfish   140 LRDYFDQFGKIEVVEIMVDHKTGNK-RGFAFVTFD---DHD----SVDRIVIQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/79 (24%)
RRM 128..202 CDD:214636 20/68 (29%)
hnrnpa1bNP_956398.1 RRM <19..187 CDD:223796 47/183 (26%)
RRM_SF 31..111 CDD:302621 21/85 (25%)
RRM2_hnRNPA1 124..200 CDD:241024 20/69 (29%)
HnRNPA1 367..>387 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.